PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000252887
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 370aa    MW: 41746.9 Da    PI: 9.9135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000252887genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.6e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++mg  + R +k+c +rw +yl
    MDP0000252887  4 RQRWQPEEDALLRAYVKQYGPKEWSLVSQRMGkpLLRDPKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding378.1e-1259103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l v + +++G++ Wk+Ia++++ gRt+k +  +w  +
    MDP0000252887  59 KGSLTPEEQALVVSLQAKHGNK-WKKIAAELP-GRTPKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.221157IPR017930Myb domain
SMARTSM007172.4E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-21499IPR009057Homeodomain-like
PfamPF002492.2E-13453IPR001005SANT/Myb domain
CDDcd001671.75E-9653No hitNo description
Gene3DG3DSA:1.10.10.602.1E-20660IPR009057Homeodomain-like
PROSITE profilePS5129418.5158108IPR017930Myb domain
SMARTSM007174.5E-1058106IPR001005SANT/Myb domain
PfamPF002496.3E-1059100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-1661107IPR009057Homeodomain-like
CDDcd001675.82E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MKERQRWQPE EDALLRAYVK QYGPKEWSLV SQRMGKPLLR DPKSCLERWK NYLKPGLKKG  60
SLTPEEQALV VSLQAKHGNK WKKIAAELPG RTPKRLGKWW EVFKEKQLKL QSQRQKNKHL  120
LCSTSSSSTQ LPPDMNIPVA GIGSPEKAVK GPYDHILETF AEKYVVQPKV YGAAFQSTTM  180
MQEPDPVLSL GSVGSTATSV TAPSVMPQWM NINPSSTTSS TSSTTPSPSV SLTLSPSDPV  240
PDTDPTRFYQ MGTLIQLCKE VEEGMQSWMQ QKKEATWRLS RLEQQLEAEK GRKRREAVEE  300
IEAHIRCLRQ EEVALVGRIE RDYREELSAL QREAEGKEAK FVEAWCGKHA KLAKLVERIA  360
VGVGFSSKPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-157100797MYB PROTO-ONCOGENE PROTEIN
1msf_C6e-157101798C-Myb DNA-Binding Domain
1mse_C6e-157101798C-Myb DNA-Binding Domain
1h8a_C1e-14710030120MYB TRANSFORMING PROTEIN
3zqc_J1e-14111159110MYB3
3zqc_G1e-14111159110MYB3
3zqc_D1e-14111159110MYB3
3zqc_A1e-14111159110MYB3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159880.0bud| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744740.0DQ074474.1 Malus x domestica MYB92 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341864.10.0PREDICTED: protein rough sheath 2 homolog
TrEMBLQ2LMD80.0Q2LMD8_MALDO; MYB92
STRINGVIT_14s0083g00120.t011e-134(Vitis vinifera)
STRINGPOPTR_0004s10250.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-89MYB family protein
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]